SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 398579.Spea_3138 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398579.Spea_3138
Domain Number 1 Region: 116-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.19e-41
Family Nitrogenase iron protein-like 0.079
Further Details:      
 
Domain Number 2 Region: 19-74
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000823
Family Eukaryotic type KH-domain (KH-domain type I) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398579.Spea_3138
Sequence length 346
Comment (Shewanella pealeana ATCC 700345)
Sequence
MSNKLTTLNLYLEPAETRRLASLCGPFDDNIKQLERRIGVEISYRNNHFQIVGTPRSCLT
ANNLLKDLYIETQPLKGSTPDLEPDAVHIAIQEAIALDMQAPRDESELYIKTKRGVIKPR
NPNQSDYVRNIVTHDITFGIGPAGTGKTYLAVAAAVDALERQEVRRILLTRPAVEAGEKL
GFLPGDLSQKVDPYLRPLYDALFEMMGFEKVERLIERNVIEVAPLAYMRGRTLNDAFIIL
DESQNTTVEQMKMFLTRIGFNSRAVITGDITQIDLPKHQKSGLRHSIEVLGEVDEISFNF
FQAKDVVRHPVVARIVEAYEAFELKAQSSKGNKDSQYQLQEIAPHE
Download sequence
Identical sequences A8H7B7
WP_012156356.1.79101 398579.Spea_3138 gi|157962955|ref|YP_001502989.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]