SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 398579.Spea_3437 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398579.Spea_3437
Domain Number 1 Region: 39-270
Classification Level Classification E-value
Superfamily Multiheme cytochromes 6.51e-59
Family Di-heme elbow motif 0.00027
Further Details:      
 
Weak hits

Sequence:  398579.Spea_3437
Domain Number - Region: 18-42
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00785
Family Pre-dockerin domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 398579.Spea_3437
Sequence length 273
Comment (Shewanella pealeana ATCC 700345)
Sequence
MSIDRRQALTKIIGLSTAAAGAALVGTSAFAATDADGNYRLEMGETLKYVPLDAMATAKL
AYETGGGCMHQVFHSIVTMLAQSNSVDAEKFATIPTALAGYGWAGIVGQGTICGNLNAAG
MLINILDDINGQNDAVIGATFRYYETEDLPLSSDEFVAGIGSTAEKSLEVGATSIANSPL
CHSSISNWSAASGKVFKEKGERCKRLSASLAYHIVELLNRAHGGEDISLLPEAKPSAEAQ
ACQSCHGVTETMGPAASVKTDMECTTCHTGHFN
Download sequence
Identical sequences A8H863
gi|157963251|ref|YP_001503285.1| 398579.Spea_3437 WP_012156649.1.79101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]