SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 398580.Dshi_2997 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398580.Dshi_2997
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-49
Family Ribonuclease PH domain 1-like 0.000023
Further Details:      
 
Domain Number 2 Region: 299-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.72e-45
Family Ribonuclease PH domain 1-like 0.0000151
Further Details:      
 
Domain Number 3 Region: 456-564
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.93e-28
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 145-241
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.61e-26
Family Ribonuclease PH domain 2-like 0.0024
Further Details:      
 
Domain Number 5 Region: 558-644
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.39e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 6 Region: 624-708
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.32e-23
Family Cold shock DNA-binding domain-like 0.00048
Further Details:      
 
Domain Number 7 Region: 245-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000366
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398580.Dshi_2997
Sequence length 711
Comment (Dinoroseobacter shibae DFL 12)
Sequence
MFNQVKKTMEWGEDTLTLETGKIARQADGCVIATYGETSVMAAVTYARSQKPGQDFFPLT
VHYNEKYYAAGKIPGGFFKREARPTEKETLTSRLIDRPIRPLFVDGFKNEVLVICTVLSH
DLENDPDIVAMIAASAALTISGVPFMGPIAGARVGYEDGEYVLNPVVDDMHDLRNNPDQR
LDLVVAGTKDAVMMVESEAYELSEAEMLGAVKFGHEQMQPVIDLIIELAETAAKEPFDFQ
PADYSELYAKVKAAGEDQMRAAFAITDKQERVTAISAARDAILATLSDEEQTDPNLGSAL
KKLESSILRGDVVKNGRRIDGRALDTVRPIQSEVGILPRTHGSALFTRGETQGLVVTTLG
TGDDEQFIDALHGNFKSNFLLHYNFPPYSVGEVGRFGPPGRREIGHGKLAWRALQAVLPA
ATDFPYTIRLVSEITESNGSSSMASVCGGSLSMMDAGVPLKAPVAGVAMGLILEEDGSYA
VLTDILGDEDHLGDMDFKVAGTEEGITSLQMDIKVAGITPEIMEKALEQAKAGRLHILGE
MSKALSEGRSQFSEHAPRIETMQIPTDKIREVIGSGGKVIREIVETSGAKVDINDDGIIK
IASANGEAIKKAYEMIHSIVAEPEEGKVYTGTVVKIVDFGAFVNFFGKRDGLVHVSQIEN
RRLNHPSDVLKEGQEVKVKLLGFDDRGKVRLSMKVVDQETGEEIKKEAPAD
Download sequence
Identical sequences A8LKE7
398580.Dshi_2997 WP_012179658.1.38649 gi|159045537|ref|YP_001534331.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]