SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 398767.Glov_1362 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398767.Glov_1362
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily Translational machinery components 7.63e-47
Family Ribosomal protein L18 and S11 0.0000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398767.Glov_1362
Sequence length 122
Comment (Geobacter lovleyi SZ)
Sequence
MGKTSQKTITRLKRQVRVRKKVTGTAERPRLNVFRSANHIYAQLIDDVQGVTLAAASTCT
EGVAQSGVHTGNKASAAAVGAAIARVALQKDIRSVVFDRNGFLYHGRIQALADAAREAGL
DF
Download sequence
Identical sequences B3E846
gi|189424426|ref|YP_001951603.1| WP_012469428.1.41214 398767.Glov_1362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]