SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE000473 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE000473
Domain Number 1 Region: 55-122
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  39946.BGIOSIBCE000473
Domain Number - Region: 161-221
Classification Level Classification E-value
Superfamily ACT-like 0.000549
Family Phenylalanine metabolism regulatory domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE000473
Sequence length 258
Comment (Oryza indica)
Sequence
MAECQPLQLQEGKKLQELQPYDGCNPSVYRGPILLPRQANSAPPAVPPEMSSSSGSGRSA
TEARALKIHSEAERRRRERINAHLTTLRRMIPDTKQMDKATLLARVVDQVKDLKRKASEI
TQRTPLPPETNEVSIECFTGDAATAATTVAGNHKTLYIKASISCDDRPDLIAGITHAFHG
LRLRTVRAEMTSLGGRVQHVFILCREEGIAGGVSLKSLKEAVRQALAKVASPELVYGSSH
FQSKRQRILESHCSIMSI
Download sequence
Identical sequences A0A0E0MRM8 B8ADE1 Q7F7Z2
XP_015623162.1.37577 39946.BGIOSIBCE000473 39947.LOC_Os01g06640.1 OsIBCD000413 LOC_Os01g06640.1|13101.m00659|protein LOC_Os01g06640.2|13101.m00660|protein LOC_Os01g06640.1|PACid:21910833 LOC_Os01g06640.2|PACid:21910834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]