SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE003106 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE003106
Domain Number 1 Region: 19-184
Classification Level Classification E-value
Superfamily FAS1 domain 2.22e-29
Family FAS1 domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE003106
Sequence length 247
Comment (Oryza indica)
Sequence
MARSVAVVVLLAMAAVAAAQAPGPAATPAAGATGPPNVTAVLEKGGQYTTFIRLMKETQQ
DTQLNSQLNNSFNGNGYTVFAPTDNAFNNLKPGTLNSLTQQQQVALVQGHVLPQFYSMDS
FQTASNPVRTQASGTDGPYTLNITSTTNNNVNVSTGVVEVTVTNALSAVKPLAVYSVDKV
LLPFELFGVKAPAAAPTASTAKPKKGGSTEAASGPAGAEDAEPTGAASARAVGWGVAGLA
AVVGCLL
Download sequence
Identical sequences A0A0E0N0H0 A2WTL3 Q5QLS1
39946.BGIOSIBCE003106 39947.LOC_Os01g47780.1 XP_015627386.1.37577 LOC_Os01g47780.1|13101.m04948|protein OsIBCD036696 LOC_Os01g47780.1|PACid:21905939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]