SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE005651 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE005651
Domain Number 1 Region: 29-100
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000596
Family C1-like domain 0.062
Further Details:      
 
Weak hits

Sequence:  39946.BGIOSIBCE005651
Domain Number - Region: 117-139
Classification Level Classification E-value
Superfamily Kringle-like 0.022
Family Kringle modules 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE005651
Sequence length 254
Comment (Oryza indica)
Sequence
MAAADNLPAEVSHSRLGEPGEGTRYTSGDLVLHTHCALAAPTLQHPLVKGDMVLRHVAPT
GRDAVLCDACYGAVRGFHYHSSTGGLDLHPGCAKMPLSITLQEGGATFDFVLRRKVKHRC
SSCRAMEGYYRPWCYRSKNIPDHHQRVYLHINCIKEIMAGLGHGGGGEASKMHRHEIMAA
GSSRGADAAGGEGANDRVNRVIARLQERAGGGGSSKSKLVRRVCEVLVMLMRVVMGVLLG
DPTAPLIAFNFIMP
Download sequence
Identical sequences 39946.BGIOSIBCE005651 OsIBCD005094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]