SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE007609 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE007609
Domain Number 1 Region: 124-623
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.8e-164
Family Calponin-homology domain, CH-domain 0.00000000000291
Further Details:      
 
Weak hits

Sequence:  39946.BGIOSIBCE007609
Domain Number - Region: 12-92
Classification Level Classification E-value
Superfamily EF-hand 0.00447
Family Calmodulin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE007609
Sequence length 673
Comment (Oryza indica)
Sequence
MSSFVGVLVSDPWLQSQFTQVQLRTLKTKFVSVKKSDADHVAVKDLPPVMEKLRGIHEVL
SEEEISTFLGESYPDMNQTIEFESFLREYLNLQAKGSSKTGGKKKLKGSVSFLKASTTTL
LHVINESEKTSYVNHINNFLGEDSFLKNFLPLDPSTNDIFNLVRDGVLLCKLINVAVPGT
IDERAINTKKDPNPWERNENHTLCLNSAKAIGCTVVNIGTQDLIEARPHLVLGLLSQIIK
IQLLADLNLKKTPQLAELVADDNSKEAEELVTLAPDKMLLKWMNFHLKKAGYKKTVTNFS
TDVKDGEAYAYLLNTLAPELSSTTMIETSDPNERAKKVLETAEKLECTRYVTSKDIVEGS
ANLNLAFVAQIFHHRNGLSDNNVAPVVQDTPDDVEATREERAFRLWINSLGIATYVNNLF
EDVRTGWVLLEVLDKISPGIVNWKQASKPPIIMPFRKVENGNQVIEIGKELKFSVVNISG
NDIVQGNKKLILAFLWQLMRTSILQLLKNLRTHSKDKEITDADILIWANNKVKESGKTSC
IENFKDKSIANGVFFLELLHAVNHRHVDLSMVKKGEDDEEKKSNATYTISVARKLGCTLF
MLPEDIMEVNPKMILVLTASIMYWSLQKHGPYQVPEPVPQETLAEEEEEDEEGDFEEDEE
EESIEDGVSNLTT
Download sequence
Identical sequences B8AEP1 I1P1P5
39946.BGIOSIBCE007609 OsIBCD007030 ORGLA02G0190100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]