SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE011680 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE011680
Domain Number 1 Region: 47-176
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.47e-44
Family CCP-like 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE011680
Sequence length 176
Comment (Oryza indica)
Sequence
MPTMWDASPSSHNTPCGPARQRSLGKLTSFPLPFSTSLVDAVEAANGAHTIGRAQCANFR
DRIYNDTDIDASFAASLRAGCPQSGDGSGLAPLDESSPDAFDNGYFGGLLSQRGLLHSDQ
ALFAGGGGSTDGLVRSYASSNDQFASDFSTAMVKMGNISPLTGSAGEIRVNCRAVN
Download sequence
Identical sequences A2XIB5 Q60DE0
OsIBCD010687 39946.BGIOSIBCE011680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]