SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE012661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE012661
Domain Number 1 Region: 747-1058
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.02e-71
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 533-676
Classification Level Classification E-value
Superfamily L domain-like 2.45e-25
Family Polygalacturonase inhibiting protein PGIP 0.0062
Further Details:      
 
Domain Number 3 Region: 26-177
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.23e-18
Family Calponin-homology domain, CH-domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE012661
Sequence length 1106
Comment (Oryza indica)
Sequence
MRTAQQQQQKQQGGVVRVDQASPASSFRELDDAFLQTQTKIWLGEVLHLRFDEAVIVADL
LADGELLFQVSKVLWKRLVRMNKEQMKQSKVYIYERTSSGKSNGKYMPYPKVDSFLKICQ
ILGLAGIDLFTPSDVVEKRNVRKVCMCIRLLSKKARTMRLTVPDFDIVTHTIAMPNYIVG
GIRRSLEQPQCSSSGSSGYSPSANSKALNQQRVFGAENDQQCETHYDSDEAESKLSALEP
EDSVSEDNISTLLKSGNMPKEEKEGYGDSEHGMHEEKSLSESVGSIDFGNMESDSVGSTP
LFHKNESYCCIESPTDQCSRTRTIRCSLSSEESDSISSHLVVDSSKAKRTHGEHLEPLNG
NGKRFANDPEKESDALQKVTFDQQCDMLACDGESVCSNCDSTPYSSLTPIDSACGKLPAV
SEDDSACRGLELEFRCGNETDVSQKEDKQVESEYKAENDSSAQMNENDVPKSGKGMLKSV
AGGITLVGAVFFIAHLRRSKDRSFAGVIAPFSEKSVQGDSRAKKVEKTKAGDALYDMKLK
LNATGNQLSDWNQNQVNPCTWNSVICDNNYNVVQVTLASMGFTGVLSPRIGELQFLNVLS
LPGNKITGGIPEQIGNLSSLTSLDLEDNLLVGPIPASLGQLSKLQILRLAYNKLSGSIPG
SLFQVARYNFSGNNLTCGANFLHPCSSSISYQGSSHGSKVGIVLGTVVGAIGILIIGAVF
IVCNGRRKSHLREVFVDVSGEDDRRIAFGQLKRFAWRELQLATDSFSEKNVLGQGGFGKV
YKGALPDGTKIAVKRLTDYESPGGEAAFLREVELISVAVHRNLLRLIGFCTTQTERLLVY
PFMQNLSVAYRLRDSILEDFNMYLIVFNDAEFKPGEPILDWSARKRVAIGTARGLEYLHE
HCNPKIIHRDVKAANVLLDEDFEPVVGDFGLAKLVDVQKTSVTTQVRGTMGHIAPEYLST
GKSSERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLQREGQLGAIVDRNL
SSNYDGQEVEMMIQIALLCTQASPEDRPSMSEVVRMLEGEGLAERWEEWQQVEVTRRQDY
ERMQQRFDWGEDSIFNQEAIELSAGR
Download sequence
Identical sequences 39946.BGIOSIBCE012661 OsIBCD011705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]