SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE014224 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE014224
Domain Number 1 Region: 7-44
Classification Level Classification E-value
Superfamily F-box domain 0.00000000706
Family F-box domain 0.003
Further Details:      
 
Weak hits

Sequence:  39946.BGIOSIBCE014224
Domain Number - Region: 57-127
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0746
Family Quinohemoprotein amine dehydrogenase B chain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE014224
Sequence length 253
Comment (Oryza indica)
Sequence
MAAAAADWTSLPDDILFLVMRQLGIPDLLNAGAVCSSWRPTYSSLRLPITDKSPCLLYSC
DADADADDDDVATVYSPSSGATFKLRLPAPAFRRRYMVGSDHGWVATADELSNLQVWRCR
DPRWVDTPVRFPLEDCDDVYDPCQELYTDEILLFKVDIDGQKLVKMDSLEDYVLFMGFNS
SVCLSAKDFPNLKAGCAYLADDAYEEICVNKHTWRELGIWNFKSETLESFGDPPSVLPWL
NWPPPIWITPSIY
Download sequence
Identical sequences A2XQL6
39946.BGIOSIBCE014224 OsIBCD013232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]