SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE014398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE014398
Domain Number 1 Region: 10-69
Classification Level Classification E-value
Superfamily DNA-binding domain 3.73e-24
Family GCC-box binding domain 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE014398
Sequence length 130
Comment (Oryza indica)
Sequence
MEDDKKEAASKYRGVRRRPWGKFAAEIRDPERGGSRVWLGTFDTAEEAARAYDRAAFAMK
GAMAVLNFPGRTSSTGSSSSSSSSSTPPAPVTTSRHCADTTEKVELVYLDDKVLDELLAE
DYSYRNNNNY
Download sequence
Identical sequences A0A0E0GY74 A2XR35
ONIVA04G03680.1 39946.BGIOSIBCE014398 OsIBCD039859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]