SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE014931 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE014931
Domain Number 1 Region: 95-221
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.47e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000398
Further Details:      
 
Domain Number 2 Region: 336-425
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-27
Family Canonical RBD 0.00088
Further Details:      
 
Domain Number 3 Region: 213-259
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000907
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE014931
Sequence length 684
Comment (Oryza indica)
Sequence
MKDFAADLDPEVHNLNARLLEISRMLQSGLPLDDRPEGARSPSPEPVYDNLGIRINTREY
RARERLNRERQEIISQLIRRNPAFKPPADYRPPKLQKKLYIPMKEFPGYNFIGLIIGPRG
NTQKRMEKETGAKIVIRGKGSVKEGKLLQKRDMKPDPSENEDLHVLVEAETQEALDAAAG
MVEKLLTPVDEVLNEHKRQQLRELAALNGTIRDDEFCRTCGEPGHRQYACPNRTSTFKSE
VQCKICGDGGHPTIDCPVKGTTGKKMDDEYQNFLNELGGSAPESVTKSSGPMLALTGSGG
SGGSSGGVGAGSGSNPPWAAGGGAAASGANGIKKEYDETNLYIGYLPPTLDDSGLIGLFS
QFGEIVMAKVIRDRITGQSKGYGFVKYSDVSQANAAIAAMNGYHLEGRVIAVRVAGKPPQ
PAVPPGPPAVPAPPTYPPADPAAGGYTSQPYMGAPPPPPPGSYAPVPWGQPPPYASYPPP
PPGSSMYNPPPPAPGQATPPPYGVQYAPPPAPIPPPGTAPSTDGAQNYPPGVTPPSSGAP
TQPVPAPVYGTSGAPNAPPMYPPPPYGYASYYPSVTPVQPPPPPPPAGADPSQSLANAPW
ATHSAPPPPPSGADPSQSIANAPWATHSAPPPPPATADHSQSIASAPWATHNAPPPPPPP
SSIEQPPPTYGADAEYDKFMSEMK
Download sequence
Identical sequences A2XSQ6
39946.BGIOSIBCE014931 OsIBCD040063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]