SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE015205 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39946.BGIOSIBCE015205
Domain Number - Region: 3-35
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000209
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE015205
Sequence length 213
Comment (Oryza indica)
Sequence
MDTDKATIVEATINYIKNLQDKIHKMEMLKVEREHAIALATAATATAAASADTALQAPPP
SEEENEEHDSGVAAATREMALADMVHAWEQQQEAAATGGSHGGHAVPPPPPAASLQTWTG
PNMTASLTGDDGFITLSLPHQGGQKNLVAGAVSVLERHHIDVVTATVSASEQGDNLISLH
CHLSPGSSSSQNLTPLDKFKLAMSELMLWVISV
Download sequence
Identical sequences B8ATS9
OsIBCD014351 39946.BGIOSIBCE015205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]