SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE016841 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE016841
Domain Number 1 Region: 61-119
Classification Level Classification E-value
Superfamily DNA-binding domain 1.83e-21
Family GCC-box binding domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE016841
Sequence length 232
Comment (Oryza indica)
Sequence
MQGEYHRSSSEDSAASAAAAAAAAAAAMAPLAAAAAAVAAKEEQAAAAAVLPLQQQQPRR
QYRGVRMRKWGKWVAEIREPHKRTRIWLGSYATPVAAARAYDTAVFYLRGRSARLNFPEE
ISSLASLSEGGGASEPREPDGGTLSAASIRKKAIEVGSRVDALQTGMMVAPTTHHRERQK
HHHHHHHHPHLQPHGEEQHHHHEQKHQRTAWSGRAKNPDLNQAPSPENSDAE
Download sequence
Identical sequences A0A0E0H6N8 A2XYA3 Q25A30
39946.BGIOSIBCE016841 OsIBCD040543 ONIVA04G25910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]