SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE017266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39946.BGIOSIBCE017266
Domain Number - Region: 22-42
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00667
Family Rad50 coiled-coil Zn hook 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE017266
Sequence length 80
Comment (Oryza indica)
Sequence
MASYHQQQGGSTFMAIPTINFQVCPICADNLDKDTDEHFRVQHSHLLKVEYSISHCFHSD
FTATSAMIRHCNLQTTLELL
Download sequence
Identical sequences A2XZI7
39946.BGIOSIBCE017266 OsIBCD016190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]