SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE018987 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE018987
Domain Number 1 Region: 50-147
Classification Level Classification E-value
Superfamily DNA-binding domain 2.03e-16
Family Methyl-CpG-binding domain, MBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE018987
Sequence length 175
Comment (Oryza indica)
Sequence
MALEGKPGFITMYAITCCKCEKWRTIPTKEEFEVIRENYPAKPWFCSKKRDCSCEHPEDI
QYDTSRIWAIDRPNIPKPPPKTERLLIMRNDLSKMDAYYVLPNGKRAKGKPDIDRFLKEN
PEYAATLPLSSFNFSTPKIVKETVSDSAKWVMAKSEREEQCMQLDAKEVPSSSSK
Download sequence
Identical sequences A0A0E0HE97 A0A0E0PMB3 A2Y4I9 Q0DIA3
LOC_Os05g33554.1|PACid:21939296 ONIVA05G16570.1 LOC_Os05g33554.1|13105.m03472|protein 39946.BGIOSIBCE018987 39947.LOC_Os05g33554.1 XP_015639327.1.37577 OsIBCD017953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]