SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE019116 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE019116
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.0000000000209
Family CCP-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE019116
Sequence length 93
Comment (Oryza indica)
Sequence
MAPVPPGNYNSNNVAALDVGSEYGFDTSYYANRTVRARVRRHAPLAKTLPKLIQLKGNQT
QFTSSFANAMVKMGNLRGGYPGEVCDNCRRVRT
Download sequence
Identical sequences 39946.BGIOSIBCE019116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]