SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE020586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39946.BGIOSIBCE020586
Domain Number - Region: 84-156
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.0561
Family MgsA/YrvN C-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE020586
Sequence length 167
Comment (Oryza indica)
Sequence
MWVSGWHHTVSGSQTRWSRKSVLQCYHLNEWSVKRAQKKKLMSAVTRAYLDQKLALAKRC
SRVYLGSYTLVVEIVAEATLAGAKAATVASAVPTLASVRMLPWAKANINPTGQALIICTA
AGMTYFVAADKKILSLARRHSFENAPEHLKNTSFQGTGHPHPPFFRP
Download sequence
Identical sequences 39946.BGIOSIBCE020586 OsIBCD019347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]