SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE022629 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE022629
Domain Number 1 Region: 180-272
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 271-302
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000523
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 110-141
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000471
Family CCCH zinc finger 0.0024
Further Details:      
 
Weak hits

Sequence:  39946.BGIOSIBCE022629
Domain Number - Region: 57-72
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0288
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE022629
Sequence length 307
Comment (Oryza indica)
Sequence
MEAGGGKRAAPEGTNGAAKRARGWLVPRVSPAGYLVGGLGFSAALRLGFELGGDCTSGCP
FGSSCHFLHNFPGGYQAAAKMTSHGGTAVAAPPGRMPLGPGAPNGPPTSSVKTRMCNKYN
TAEGCKWGSKCHFAHGERELGKPMLLDNSMPHPMGSMPFEAPPMPGPDIVPPSTFGASAT
AKISVDASLAGGIIGKGGTNTKHISRMTGAKLAIRDNESNPNLKNIELEGTFDQIKHASA
MVTELIVRISGNVPPAKNPGRGSHAGGPGSNFKTKLCENFNKGSCTFGDRCHFAHGESEL
RKPPAAA
Download sequence
Identical sequences B8B4M2
OsIBCD021408 39946.BGIOSIBCE022629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]