SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE023832 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE023832
Domain Number 1 Region: 392-589
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-46
Family Ribonuclease PH domain 1-like 0.0000273
Further Details:      
 
Domain Number 2 Region: 196-279
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.03e-23
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 
Domain Number 3 Region: 547-649
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.26e-22
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 
Domain Number 4 Region: 717-799
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.04e-16
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Domain Number 5 Region: 91-175
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-16
Family Ribonuclease PH domain 1-like 0.0014
Further Details:      
 
Domain Number 6 Region: 659-745
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000173
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Weak hits

Sequence:  39946.BGIOSIBCE023832
Domain Number - Region: 287-338
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000201
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE023832
Sequence length 865
Comment (Oryza indica)
Sequence
MLATPGALHHLLLLPPPPHTQLAFHHAVGGVPAALLPLPRPRRVAASASTSRRGGARRRA
AGARVRASVGEEAPPVVTEEASTSGGPTKFSTKIPVGDRHILVETGHIGRQASASVMVTD
GETVLVCRLIDRPLRPTMPKGFYYETQILSWVFSYDGIHSPDSLAITAAGVAICSCSYLP
QSFLCRALSEVPNKQTIAGVRIGMINDQFVVNPTTEQMDDSELDLVMAGTDSAILMIEGY
CDFLTEEKLLQAVETGQGAIREICKAIDGLVQKCGKKKMFDAIDLPPPELYRHVEDISGD
ELVKALQIKEKILRRKALSALEEKVITILSEQGYVAKDESSGVSENLADVIEEEDEDEVI
VDGEVDEGEVHIKPVSRKPPRQLFSEVDVKLVFKEVSSKFLRRRIVEGGKRSDGRSPCEL
RPINSQCGLLPRAHGSALFTRGETQALAVVTLGDYQMAQRIDNLVDTEESKSFYLQYTFP
PSSVGEVGRIGAPNRREIGHGMLAERALEPILPPEEDFPYTIRVESTITESNGSSSMASV
CGGCLALQDAGVPIKFPVAGIAMGLVLDTLEFGGDGKPLILSDITGAEDASGDMDFKVAG
NENGISAFQMDIKVVGITLPIMEHALLQARDGRKHILNEMSKCSPPPAKVLSPYAPLIHV
MKVKPNKVNLIIGSGGKTIKSIIEETGVDAIDTGDDGTVKITARDLSSLEKSKAIIANLT
MVPKVGEIYRNCEIKTIAPYGAFVEIAPGREGLCHISELSSSWLAKAEDAFKVGDRIDVK
LIEINDKGQLRLSSRALLPDANQESSSKQQAGGSTREKAPQKDNLVKMTTRRPRRKKQAE
ASTAENNATASPKDLASQGSEMGTE
Download sequence
Identical sequences A2YIJ3
39946.BGIOSIBCE023832 OsIBCD022472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]