SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE024206 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE024206
Domain Number 1 Region: 143-275
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.3e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE024206
Sequence length 299
Comment (Oryza indica)
Sequence
MSGGLYNHQGFSPARTLSPQIRSNPEADSQYLSELLAEHHKLGPFMQVLPICSRLLNQEI
MRVSSMVNDHGFNDFDRRRYRSPSPMSSPIMRPNLHGNGFGPWNGIHQERLGFPPPPPPG
TSMDWQGAPPSHGSYIVKKIVRMEVPVDAYPNFNFVGRILGPRGNSLKRVEASTGCRVFI
RGKGSIKDADKEEKLKGKPGYEHLNDPLHILIEAELPANIIDTRLRQAQEIMDELLKPVW
ICNVKFMMKGPKDESQDYYKRQQLRELAMLNSTLREDSPHPGSVSPFSNGGMKRAKPSH
Download sequence
Identical sequences A3BHY3 B8B8H3
39946.BGIOSIBCE024206 OsIBCD022796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]