SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE029072 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE029072
Domain Number 1 Region: 12-100
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 2.09e-20
Family SWIB/MDM2 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE029072
Sequence length 102
Comment (Oryza indica)
Sequence
MVLRRATAAVGDCPKKVAKLVDLVNLPTALREFAGGQSQMSHLSFFLRVWSHIKSNNLQD
PSNRNIVNCDDKLKTVLLGRSKVELSELPMLVKLHFPKFPKS
Download sequence
Identical sequences A0A0D3H3W3 A0A0E0AZU0 A0A0E0EPP1 A0A0E0IGH8 A0A0E0QN74 A2YYP5 I1QM53 Q6K448
ONIVA09G01540.1 39946.BGIOSIBCE029072 39947.LOC_Os09g04720.1 ORGLA09G0013200.1 OsIBCD027639 OGLUM09G01910.1 LOC_Os09g04720.1|13109.m00406|protein XP_015610840.1.37577 OBART09G01510.1 LOC_Os09g04720.1|PACid:21924838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]