SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE030453 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE030453
Domain Number 1 Region: 322-405
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 245-322
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000264
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 3 Region: 104-187
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000964
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 4 Region: 543-610
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000142
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE030453
Sequence length 617
Comment (Oryza indica)
Sequence
MEISPNSAAAAAAAATAAAPASSSTSSPSAPKRLTTTLRILCPSSRASALRGASRDLHVD
QPPVGDEAVLSISGPDAPAVAVRAWERVVGHRVGGDEAAGEEEREVPGVVGCRMLAASGQ
VGCVLGKGGKTVERMRQESGAQIRVFRNRDQLPPWAAPVDELIHISGNFSAVRKALLLVT
TCLQDNPRPDASNFPPGRFGPPGPVGIDPHSQRGYLPPSMPDYHARNYSSNMAAPGPRFF
VEQEIVFRMICLNEMVGSIIGKGGSTIRALQSETGASIKIIEPNSDSEERVIVISAHENS
EMMHSPAQDAVLRVHSRISESSMDKSSAVTARLLVPSQHIGCLLGKGGSIIAEMRKITGA
GIRIFGNEQIPRCAQRNDELVQVTGSFQSIQDALLHITGRIRDVIIPMKPHPGGGMPPYP
PGGNAPPHHPRQEPAPPHPTGGMPPYPMPSFRADRPMGPFDMVDHRPPPPHSMEHMGADR
MPYSYGCEQGGGPRPFLDQPSPSAWAPEAPNSEAPRNMPETVPPADFRKGAVAGTNQVAT
PSNATEVIIPRKYIGFICGANGSDLAEIKKMSGATITVHHPKPGDANALVIICGDPDQTK
KAQSLLHAFIFCGLYQT
Download sequence
Identical sequences B8BD38
OsIBCD029002 39946.BGIOSIBCE030453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]