SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE032636 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE032636
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-41
Family Calponin-homology domain, CH-domain 0.0000504
Further Details:      
 
Domain Number 2 Region: 197-253
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.1e-19
Family EB1 dimerisation domain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE032636
Sequence length 332
Comment (Oryza indica)
Sequence
MAASNIGMMDGAYFVGRNEILAWINTTLQLGLSKVEEAASGAVACQLMDAAHPGAVPMHK
VNFDAKTEYEMIQNYKVLQDVFNKLKITKHIEVNKLTKGRPLDNLEFMQWMKRYCDSVNG
GFMNSYNASERRESSKGGKETNRRTSVPSQAPAKSSSATHKAQALSHGAKKANGHAPNAP
PSRSAKPSPANSAGPAYDEQITELKLLVDSLEKERDFYFSKLRDVEILCQSPEVEHLPIV
NAIHKVLYAAEDDPSMVAEAQAMISQQQQSEQPMLSPILEASEERPAKQEAHKRKSISDL
ELEEFGMASSSRQRLSDISDVQLCGSPLTSFT
Download sequence
Identical sequences A2Z906
OsIBCD031103 39946.BGIOSIBCE032636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]