SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os01g01350.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39947.LOC_Os01g01350.1
Domain Number - Region: 16-52
Classification Level Classification E-value
Superfamily Prefoldin 0.0144
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os01g01350.1
Sequence length 232
Comment (Oryza sativa)
Sequence
MKKIFGAKKSKDPPPSIQDATERINKRGESVDDKIKKLDEELGRYKEQIRKTRPGPSQDA
IKARAIRLLKHKRMYEEQRNMLYNQTYNLDQVAFAADGLKDAQQTMNAMKAANKELKGMM
KTVKIEDIDNMQDEMTDLMDVSNEIQESLGRSYNIPDDVDEEELMGELDALEADMEFESS
AVPSYLQPDKESDFDAELNLPAAPTAPAAVPVSRQQVDELGLPAVPRASIRS
Download sequence
Identical sequences A0A0D3EIL5 A0A0D9Y222 A2WJN1 Q9FTZ4
39946.BGIOSIBCE000024 39947.LOC_Os01g01350.1 OGLUM01G00220.1 LOC_Os01g01350.1|PACid:21903298 OsIBCD000023 OBART01G00250.1 LOC_Os01g01350.1|13101.m00049|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]