SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os01g47256.4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os01g47256.4
Domain Number 1 Region: 69-162
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.5e-22
Family Cold shock DNA-binding domain-like 0.00095
Further Details:      
 
Domain Number 2 Region: 157-237
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.02e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.00077
Further Details:      
 
Domain Number 3 Region: 10-69
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 9.21e-18
Family ECR1 N-terminal domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os01g47256.4
Sequence length 239
Comment (Oryza sativa)
Sequence
MESRKPPPSALVDNHVVPGDVVLDLAEMTNQTIKLGAGLRQDCDTIQATSAGRLRLSKPS
KYWVESSQKRYIPSVEDTVLGVVVDTKPDNFLVDIKGPNLAFLPVLAFEGGTRRNIPKFE
IGTLIYARVVKANSIMNPELSCMDATGKAAEFGQLKDGYMFDTSTGLSRMLLSSPTCPIL
EALGKKLSFEIAVGLNGRVWVNAPSPSNVIVVSNAIIKSESLSGIGQRSMVESLLERLS
Download sequence
Identical sequences Q0JKN6
39947.LOC_Os01g47256.4 LOC_Os01g47256.1|PACid:21908533 LOC_Os01g47256.2|PACid:21908534 LOC_Os01g47256.3|PACid:21908535 LOC_Os01g47256.4|PACid:21908536 XP_015621208.1.37577 XP_015621209.1.37577 XP_015621210.1.37577 LOC_Os01g47256.1|13101.m04864|protein LOC_Os01g47256.2|13101.m04865|protein LOC_Os01g47256.3|13101.m04863|protein LOC_Os01g47256.4|13101.m15055|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]