SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os02g03310.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os02g03310.1
Domain Number 1 Region: 201-284
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000427
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 331-394
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000716
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 3 Region: 90-136
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000102
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os02g03310.1
Sequence length 458
Comment (Oryza sativa)
Sequence
MAVPDEVAADADAEVEEEEPEEVEWLSSSSDSEPEHPALKQWTPSSPDSEEAEAEQQPSA
PQPASSVSAGKEDEGEVGLEEGEVGKPFRWPGWPGASVFRLVVATDKVGGLIGRRGDTIK
RLCEDTRARVRVLEAAAAAAANRIVDSDSNDFIAKVTFEMVLISATEESQAELPPAMDAA
IKIFMHINDIEKINCDDTLSGSAPEKCSAKLLVPSAQATHLIGKQGVRIKSIQETTGATV
KIIDKVELLSYDVVDERIVDIHGAPLKVLHALKSVLGVLRKFLVDHGVLHLFERKNQAVG
EAHDNSKENQVNQVASDYRLPVNKDILLPDHRTPLNPKITQTMQIPLPFAEEIIGARGQN
ISYIRSVSGAVVDLEESRDYPNEVLVMIKGSSSQEVLSGNKERPSGSSYINLDSGPKFLI
SGHINPVNRDHLASYRVHQPYIVRYGSSSLPRLRGYRL
Download sequence
Identical sequences Q6Z2N5
LOC_Os02g03310.1|13102.m00311|protein 39947.LOC_Os02g03310.1 LOC_Os02g03310.1|PACid:21919255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]