SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os02g13580.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os02g13580.1
Domain Number 1 Region: 811-985
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.18e-49
Family Motor proteins 0.0001
Further Details:      
 
Domain Number 2 Region: 20-115
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000166
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os02g13580.1
Sequence length 997
Comment (Oryza sativa)
Sequence
MSSSNNAAAAAASPDPSRRREDVVGWLLALFPDLPLPPPPEATDEDLRAALATGRLLCAL
LRRLCPGALLDDASTDNVGRFRAAVERMGVAKFSASDLERGQMTAVVNCILALKDRFGSR
GGDDHRNPGFLTRCDSEGGRKRVESKLQRMLTSPIMSGIPGVDKLTIATDFVMVFQLKQG
GYADQLGGKYSDLLKSTSLDNAPTQSLLGVFNSILDESIERKNGQIPYRIACLLRKVILE
IERRISTQAGHIRNQNNLIKAREEKYQSRIRVLEVLAGGMEKDKFGDKGQLAVEDMERLM
KYQDDVVRLMKENEDLVRLLREKEDMVRLLKEKEDMVRLLKEKEGMINLKTVKAEETQRI
EDEDKYRIIKEKDDALDRLVKEKEEMIRLLKEKDDVVRLMKEKEDLLNLEKGEVEGTTKM
TDDNKDRLIKEKNDVVLRLTEEKEEMVRLLKEKEDIIRLMKEKEDMVYLEKGEVEDRKQM
TDDIKDKLIKEKDDIVFRLTKEKEEIIKLLEEKEDIIILMKEKEDMVNLGKGEDEDRKQM
ADDNKDRLIKEKDDIVVRLTKEKEEIIKEKDDIVVRLTKEKEEIIKLLEEKEDIISLMKQ
KEDMFMSIKEKENKAELKKIADEDAARSIKDKAEIMRLMKEKEDGNNTILKLKKESETLR
SSYEESCRLLESKKEDVARLLTDKENNDSIISELKKELEETKRLHEAHSQQLETKAAQVS
KELEQRIEEVKLMLDDSTKRRIELEELSETRIQFWKKKEVVIDQFVSLQVQNVQDLKLSS
VSVRHEILNCQNKWSEELAGLGKSLKVVTNTAEKYHGALAENRKLFNEIQELKGNIRVYC
RIRPFRPGEDDKSSSVEYIGDNGELVLSNPTKQGKEGGKNFTFNKVFGPITTQDAVFKDI
QPLIRSVLDGYNVCIFAYGQTGSGKTYTMMGPEKATEKEWGVNYRALNDLFNISHDRRDT
ITYELGVQMIEIYNEQIRDLLGSGGVQKKYPFPPDLH
Download sequence
Identical sequences 39947.LOC_Os02g13580.1 LOC_Os02g13580.1|13102.m01508|protein LOC_Os02g13580.1|PACid:21924351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]