SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os02g49410.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os02g49410.1
Domain Number 1 Region: 33-152
Classification Level Classification E-value
Superfamily Histone-fold 1.13e-22
Family TBP-associated factors, TAFs 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os02g49410.1
Sequence length 186
Comment (Oryza sativa)
Sequence
MAGNKKRGGRNMDQVKKAAVRSDGVGGSATNAELPMANLVRLIKKVLPGKAKIGGAAKGL
THDCAVEFVGFVGDEASEKAKAEHRRTVAPEDYLGSFGDLGFDRYVDPMDAYIHGYREFE
RAGGNRRVAPPPPAAATPLTPGGPTFTDAELQFLRSVIPSRSDDEYSGSSPAIGGYGYGY
GYGKNM
Download sequence
Identical sequences Q0DXY7 Q6Z348
LOC_Os02g49410.1|PACid:21918904 XP_015624776.1.37577 LOC_Os02g49410.1|13102.m05602|protein 39947.LOC_Os02g49410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]