SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os03g21830.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os03g21830.1
Domain Number 1 Region: 24-192
Classification Level Classification E-value
Superfamily Macro domain-like 1.85e-52
Family Macro domain 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os03g21830.1
Sequence length 201
Comment (Oryza sativa)
Sequence
MAAAPGRGGGEAFRLSADAGAGALKLQKGDITLWSVDGATDAIVNAANERMLGGGGVDGA
IHRTAGPELVEACRKVPEVKSGVRCPTGEARITPAFKLPVSRVIHTVGPIYDMDKQPEVS
LNNAYTNSLKLAKQNGIQYIALPAISCGVYRYPPKEASKIAVSTAQRFSNDIKEVHFVLF
SDELYDIWRETAKEFLSQFEK
Download sequence
Identical sequences B8AP03 Q10LS7
39946.BGIOSIBCE011020 39947.LOC_Os03g21830.1 LOC_Os03g21830.1|PACid:21916556 OsIBCD010071 LOC_Os03g21830.1|13103.m02622|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]