SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os03g49630.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os03g49630.1
Domain Number 1 Region: 26-177
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.28e-18
Family Calponin-homology domain, CH-domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os03g49630.1
Sequence length 541
Comment (Oryza sativa)
Sequence
MRTAQQQQQKQQGGVVRVDQASPASSFRELDDAFLQTQTKIWLGEVLHLRFDEAVIVADL
LADGELLFQVSKVLWKRLVRMNKEQMKQSKVYIYERTSSGKSNGKYMPYPKVDSFLKICQ
ILGLAGIDLFTPSDVVEKRNVRKVCMCIRLLSKKARTMRLTVPDFDIVTHTIAMPNYIVG
GIRRSLEQPQCSSSGSSGYSPSANSKALNQQRVFGAENDQQCETHYDSDEAESKLSALEP
EDSVSEDNISTLLKSGNMPKEEKEGYGDSEHGMHEEKSLSESVGSIDFGNMESDSVGSTP
LFHKNESYCCIESPTDQCSRTRTIRCSLSSEESDSISSHLVVDSSKAKRTHGEHLEPLNG
NGKRFANDPEKESDALQKVTFDQQCDLLACDGESVCSNCDSTPYSSLTPIDSACGKLPAV
SEDDSACRGLELEFRCGNETDVSQKEDKQVESEYKAENDSSAQMNENDVPKSGKGMLKSV
AGGITLVGAVFFIAHLRRSKDRSFAGVIAPFSEKSVQGDSRAKKVEKTKAGAVYPGEWLK
V
Download sequence
Identical sequences A0A0E0P055 Q75I97
XP_015630331.1.37577 LOC_Os03g49630.1|PACid:21916792 39947.LOC_Os03g49630.1 LOC_Os03g49630.1|13103.m05393|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]