SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os03g60110.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os03g60110.1
Domain Number 1 Region: 138-257
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-32
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os03g60110.1
Sequence length 281
Comment (Oryza sativa)
Sequence
MSGLYSPGFSPARNLSPQIRSNPTDVDSQYLAELLAEHQKLGPFMQVLPICSKLLSQEIM
RVSSIVHNHGFGDFDRHRFRSPSPMSSPNPRSNRSGNGFSPWNGLHQERLGFPQGTSMDW
QGAPPSPSSHVVKKILRLDVPVDSYPNFNFVGRILGPRGNSLKRVEASTGCRVFIRGKGS
IKDPGKEDKLRGKPGYEHLSDPLHILIEAEFPASIIDARLRHAQEVIEELLKPVDESQDF
YKRQQLRELAMLNSTLREDSPHPGSVSPFSNGGMKRAKTGQ
Download sequence
Identical sequences A0A0D3FQL4 A0A0E0GVI7 A0A0E0P315 B8AM97 Q75GR5
LOC_Os03g60110.1|PACid:21916489 OBART03G38700.1 ONIVA03G40350.1 39947.LOC_Os03g60110.1 XP_015628084.1.37577 LOC_Os03g60110.1|13103.m06598|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]