SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os04g55400.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39947.LOC_Os04g55400.1
Domain Number - Region: 17-57
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.082
Family p53 DNA-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os04g55400.1
Sequence length 163
Comment (Oryza sativa)
Sequence
MWEEARLCEEKGKRRRCARRCSGHRRRQEKDEAAILVKCEHPGRAVAADAARRERFDRMA
ASDSAAAACHLWSAFDSMTWRKDPLDGLKLYSGDEHYWSGRFDGSTTATVEYMTGRGGER
ANVGHSGGDGVVEAERWSSLVTVTRWWRSERNTARKGILVIQV
Download sequence
Identical sequences A2XY90 A3AY13
LOC_Os04g55400.1|PACid:21896625 LOC_Os04g55400.1|13104.m05743|protein 39947.LOC_Os04g55400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]