SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os05g28190.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os05g28190.1
Domain Number 1 Region: 329-452
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-29
Family Ran-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os05g28190.1
Sequence length 472
Comment (Oryza sativa)
Sequence
MADEEHAPTSRKRVAGTQINKDNPEPDDDSTEQEMGTFKRASEEVMATRRIVKVRRQQPS
SAPSNPFSAIRFTPSDTSAQATIPVSEPQPSDVITANAKDSSSEKADEGSNGSGKDALPV
TDKSAGSSEVAETEKDGSDLKGSDEKAKSSDSIEPPSQPVETTDEAKDLGGGSVVAGEAK
EDNSKASDIEDKTAKEGDAEEEDGANEAGAEDKISKGDDEKKDGDESETKDGSSEEQKDA
DNKGQSSSPTPLFSFKNLSSGQNAFTGLAGTGFSGSSFSFGSGSKESSSAPLFGLKTDGS
SFPSFSIGASNNGSSSPALATSAEAPKKFAMPEGPVETGEENEKAIFTADSALYEYLDGG
WKERGKGELKLNIPVSGGERSRLVMRTKGNYRLVLNASLYEDMSLKDMDKKGVTFACMNS
IGDSQSGLATFALKFRDTSIREEFKAAVEMHKAKKASGTLKTPENSPKASDD
Download sequence
Identical sequences A0A0E0PL43 A2Y3G8 Q5W645
LOC_Os05g28190.1|13105.m02902|protein XP_015639973.1.37577 39946.BGIOSIBCE018624 39947.LOC_Os05g28190.1 LOC_Os05g28190.1|PACid:21942494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]