SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os05g40290.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os05g40290.1
Domain Number 1 Region: 142-259
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.37e-31
Family Eukaryotic type KH-domain (KH-domain type I) 0.000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os05g40290.1
Sequence length 282
Comment (Oryza sativa)
Sequence
MDGLHGTDGCFSPGRAMSPQVRPPVPPDAASGGQYLAELLQEHQKLGPFMQVLPICSRLL
NQEIMRVSGMFRQPGVGDFERSQPASPNQMHPSHIVPNFCGNAFGPWNGMRPERVSFSQG
PGWQGAPQSPSSYIVKKILRLEIPTDAYPNFNFIGRLLGPRGNSLKRIEASTGCRVFIRG
KGSIKDPNKEEQLKGRAGYEHLDDPLHILIEAELPANVIDARLAKAQEILEELLKPVDES
QDYYKRQQLRELALLNSPLREESPHPGSASPFSNGGMKRMKQ
Download sequence
Identical sequences A0A0E0DT44 A0A0E0G9E3 A2Y5U0 I1PWP1 Q0DH98
XP_015639760.1.37577 LOC_Os05g40290.1|13105.m04261|protein LOC_Os05g40290.1|PACid:21939564 ONIVA02G25730.1 ONIVA02G25730.2 39947.LOC_Os05g40290.1 ORGLA05G0178900.1 OMERI05G17530.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]