SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os06g22480.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os06g22480.1
Domain Number 1 Region: 527-627
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000018
Family Retroviral protease (retropepsin) 0.02
Further Details:      
 
Weak hits

Sequence:  39947.LOC_Os06g22480.1
Domain Number - Region: 285-401
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00489
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os06g22480.1
Sequence length 653
Comment (Oryza sativa)
Sequence
MSSPSDIVKDIVIPAKVEDLSKEHKAEMEQKMQQLKEAYLNSFSVTQQGKVIQKYKFQML
EGEGSSGQPIENPSIEPQYCKVDPNVLQYQQIPGFNFNQFQPPSPLQYRQDTPPFVQAPA
QPMYNQYEQQNQGGVQQQPLADIIADVVREQFGIKPKDNGIMYRHPYPEYFDRVPLPSRY
KTPDFSKFSGQDNVTTYEHISRFLAQSGEASAIEALRVSGAQEMKLSYLTAIRQKSDESV
PYYIQRFRDVMNRYFSLNLTDSQKVSAHEQCFQEAKKFKKVNYVYNYVSDSEEEDSEISL
AEWPKIKKKTMCRWVKDINKEEKYDFDINKADKIFDLLLQEKQIQLPVGHVLPSAEELKK
RKFCKWHNIVSHHTNECKVFSRRLINKYQKRHDIKFRGIFRIVVITKMIYIIKMTKMKNI
IKVLLERWNEVAINQQLPWVWWIEFLQSVFPGIFTRSQKRRVQRLRNREQIQEVNEKIDH
RLKRTRKEWRVESKIVIANEVENDKERNRISTSAEGKAIASTSINMPLYIKGYVNGKPMS
KMLVDGGVDVNLMPYTTFRKFGRFERDLIKTNIVLKIFGGNSSETMGVLNVELIVGSKTI
PTTFFVIDGKGSNSLLLGRDWIHANCCIPSPMHQCLIQWQGDQVEIVQADKSV
Download sequence
Identical sequences LOC_Os06g22480.1|PACid:21932558 LOC_Os06g22480.1|13106.m02416|protein 39947.LOC_Os06g22480.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]