SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os06g36080.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os06g36080.1
Domain Number 1 Region: 667-979
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.54e-85
Family Motor proteins 0.00000904
Further Details:      
 
Domain Number 2 Region: 11-135
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000339
Family Calponin-homology domain, CH-domain 0.0072
Further Details:      
 
Weak hits

Sequence:  39947.LOC_Os06g36080.1
Domain Number - Region: 434-500,717-761
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00138
Family Motor proteins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os06g36080.1
Sequence length 1147
Comment (Oryza sativa)
Sequence
MSSAAADRRRAEAVAWLRALLRGCGGGGGGQPLPPPHASEDDLRAALADGALLCAALRRL
GCDPAAASDEGTGSAAAAAAAAGEGDVGRFLAAAERMGLPGFSPSDLDTGPVSSVVTCLL
ALRDQFVSHDVGGLSCSLPEKVMMQSMEFPRKENDPGTQNSEGRRKIPKNPAMSEPSSPL
SQTTLSSISRHAGHSFHDVFQLRQGRYSDLPSSKISEMMKSTSLDNAPTQSLLSVVNVIL
DELVETKIGEIPYHLACLLRKVILEIERRISTQAEHIRNIIPVVIVACMQQNNLMKAREE
KYKSRIRVLEALASGTSDQTHVNSNATNGKAHVSPDHAVHQMKMEKDKTEDKKRLAEKDV
VLLVKDKEEDVTRLTKDKEDMAKLLKDKEDIIRLMKEKEEMVWMMREKENMVSLNNGRVE
DKHQLTDKDVANSAKYRNEIIKLMKEKEDSNDTIMKLNIELEAMKSSYEGTRILLDSKKK
EVLQLLMDKESIEYIVSQLKQELAIERSSHQTHIQELETRAFQANNKLEQRIKEMELMLE
DSKTRVRDLEELLESRSQIWEQKEIRLNQFIGLQIQNIQDLRLSSVSIRHEILHCQKRWS
EEICDLGQSLKVLTNAAENYHATLEENRKLFNEVQELKGCKANSIAHLYADILNYQLLIL
YAYLSGNIRVHCRIRPFLPGEDQTSTTIEYVGDNGELILANPAKRGKEGHKLFKFNKVLG
PSASQDEVFKEIQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPENATEKDWGVNYRALN
DLFHISRSRRDTVMYKVSVQMIEIYNEQIHDLLGNSGSEKKYPFGSQALNQPNGLAVPDA
TMHPVNSSSDVIELMRTGLENRSVGATALNERSSRSHSVVTMHIQGVDLKTGVTLRGALH
LVDLAGSGNAKTLMFVQVNPDVSSYAETLSTLKFADRVSGVELGAAKANKEGKDIKEFKE
QLSLLKDKIAKKDEEISRLQLQSHNTPRATAKRADSLLKHSSSSPGISSLGSKIQHRRTA
SGGRIKIVGSRAGSDVDNFSDISDRHSEAGSMQSVDDIQQSREIMGLSKLSMSEMGHNSV
DPELPCFGYDDSEGRLSDISDSGLSMGAETDCSMSSVVELTSLPDQDRVSGTQKEQHMAP
STPKDRL
Download sequence
Identical sequences 39947.LOC_Os06g36080.1 LOC_Os06g36080.1|13106.m03726|protein LOC_Os06g36080.1|PACid:21932938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]