SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os07g25740.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os07g25740.1
Domain Number 1 Region: 175-231
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Weak hits

Sequence:  39947.LOC_Os07g25740.1
Domain Number - Region: 4-51
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00891
Family Eukaryotic type KH-domain (KH-domain type I) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os07g25740.1
Sequence length 233
Comment (Oryza sativa)
Sequence
MNNTTRTKMKILEETAVPACASQYELVLQITGEPMNVRDALSLVCEKLRNHCFSSEKTTY
GNGHVPSSAIDELTTSSQNEIDSVQNSISAFDLGCLGSPQIQKPTIGCGTEINNPINEVE
KPANGNGTGINNLNTGMQNENGIDVSNHGATSLEEKKLLRGIKTATITRITYEVAVCGDN
GNDFTMIREMSGADVTAHYPLPETSDGMIVISGTPDEAQSALAMFLDLVKEGQ
Download sequence
Identical sequences Q6Z154
39947.LOC_Os07g25740.1 LOC_Os07g25740.1|13107.m02548|protein LOC_Os07g25740.1|PACid:21902095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]