SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os07g33370.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os07g33370.1
Domain Number 1 Region: 276-547
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.97e-36
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 
Domain Number 2 Region: 871-994
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000146
Family Armadillo repeat 0.015
Further Details:      
 
Weak hits

Sequence:  39947.LOC_Os07g33370.1
Domain Number - Region: 817-862
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0117
Family Motor proteins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os07g33370.1
Sequence length 1052
Comment (Oryza sativa)
Sequence
MSRREPAVSSPFRDLSNLRTPNPRAPPNPKSSASKEEPLPSATPTTRRRRGPPPPPRPGA
ATATPLARRLRALELDQSRSARRAESGRDGALRAFASSATSWLSLLLRDPSACGCAPSAA
AARVTRDAPAHGVQGKRDAVDGERARGRSPKRHRGGEDRGGPGPRRKTMTPAMAASLRDS
LREVCSLDDVTERMGSHMSREACEEVLVMMCQICKNIDNGRLKMKEHCPLVSDLRLRDKA
IRIFMCYNPKWLRIGLHIVLGGDSWIQNESQKKDKEVAFLKFVLEKQLFVHMNTQPSALN
KAPEGHRRACYAEAASNSILKRLFLLVAALDRAKIESGLPSESGIDGLDGGSPLLFCRQT
EIKSSRQIVQESLGEVMHGEGDLLMHLNIMGYKLNYQQLALSEYDFTVGNLFEDLQDGII
LCRIIQLLTSDASIILKVIAPSDTYKKRLHNCTMAIQYIKQAGFPLSDADGLSISAEDIV
NGDKELILALLWNMFIYMQLPVLVNETSVAQEISRLKAPVSEQSISEMKSQTGLLYDWIQ
ETLSDCRKELFSCHKTDMIADITTYQFNNIGKVLAQFLQDLPGWNILANDVLFVEKSAII
LLAFLSSHLTNVRRLEQLKNLIDSKLDHQSLVTEVSPRRRSRGTTDMKCHFPQTEETDGS
RSTREWAATVIQTQARRLNAMSKYCKLKNATQPCNKGHDPASSSPLKSIADSSCIDSATK
LVCEDDVDCSSNSCQVLFYHDPVSTKVDFLFCRKAMAARKIQFAYRRFAHRIRSRISAAI
KIQSHWRCFSVRIRFKRQIQNITTIQAVARLLVTGIWKRSVIVIQAHVRGWIARQTAVRN
KKRITIIQSYVKAYLLRKRSKQEITDDIMCLINRLIAAVSQRSISTIRQICATLSTATEH
SEKCCQTIVNAGAVEILLKQINLLNRGVPDQEVLKQVLFTLRNIARFRNLQPVLANTPQA
VEIVFQELLRSKTEGFFVACDILKRLCESEEGHKIARALKRHIRRLGCLVQELEKKVDLD
KRNGRTGVAKDNNLRRLGEAVTLHHLFTNDHC
Download sequence
Identical sequences 39947.LOC_Os07g33370.1 LOC_Os07g33370.1|13107.m03391|protein LOC_Os07g33370.1|PACid:21899132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]