SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os08g10030.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os08g10030.1
Domain Number 1 Region: 121-212
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000414
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 197-278
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 3 Region: 374-452
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000167
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os08g10030.1
Sequence length 454
Comment (Oryza sativa)
Sequence
MSFDNFVQITGDARAVRKALFAVSTIIYKCPSKETIPLETSVSDLPPSIIVPSELPVYPS
SNFYSPSDAAISSGHPSLSILGSTPHVPELTVSADAHSRLPIYQSVLPVIPAYNTPKCSG
ELVLRVLCPAGKIGLVIGKGGVTIKSIRKESGARIDVDDSKNDREESIITITSNEATDDA
KSAAVEAVLLLQSKINDDNEGKMNLRLLVPGKVIGCLIGKGGSIVNDMRSKTKAAIYISK
GEKPRKASSSDELVEVFGEVENLRDALVQIVLRLRDDVLRDSVDRQNSEKDGKLTVATTD
PLYASSYPLPALLPYRQQITPLGYDHRGDIERGLEVYPHSSLYGYSSLQAIDDGYSAVSS
YASKGYGGYVGTELPMNPDLKRPPHMEMTIPASGLSKVMGKHGTNLDNIIKISGAHIEII
ESKSSRHGHVARISGTTEQKQSAENLIKAFIMST
Download sequence
Identical sequences LOC_Os08g10030.1|13108.m01063|protein LOC_Os08g10030.1|PACid:21889228 39947.LOC_Os08g10030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]