SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os09g32300.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os09g32300.1
Domain Number 1 Region: 321-404
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 244-321
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000264
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 3 Region: 103-186
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000964
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 4 Region: 542-609
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000142
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os09g32300.1
Sequence length 616
Comment (Oryza sativa)
Sequence
MEISPNSAAATAAATAAAPASSSTSSPSAPKRLTTTLRILCPSSRASALRGASRDLHVDQ
PPVGDEAVLSISGPDAPAVAVRAWERVVGHRVGGDEAAGEEEREVPGVVGCRMLAASGQV
GCVLGKGGKTVERMRQESGAQIRVFRNRDQLPPWAAPVDELIHISGNFSAVRKALLLVTT
CLQDNPRPDASNFPPGRFGPPGPVGIDPHSQRGYLPPSMPDYHARNYSSNMAAPGPRFFV
EQEIVFRMICLNEMVGSIIGKGGSTIRALQSETGASIKIIEPNSDSEERVIVISAHENSE
MMHSPAQDAVLRVHSRISESSMDKSSAVTARLLVPSQHIGCLLGKGGSIIAEMRKITGAG
IRIFGNEQIPRCAQRNDELVQVTGSFQSIQDALLHITGRIRDVIIPMKPHPGGGMPPYPP
GGNAPPHHPRQEPAPPHPTGGMPPYPMPSFRADRPMGPFDMVDHRPPPPHSMEHMGADRM
PYSYGCEQGGGPRPFLDQPSPSAWAPEAPNSEAPRNMPETVPPADFRKGAVAGTNQVATP
SNATEVIIPRKYIGFICGANGSDLAEIKKMSGATITVHHPKPGDANALVIICGDPDQTKK
AQSLLHAFIFCGLYQT
Download sequence
Identical sequences A0A0N7KR20
XP_015612675.1.37577 XP_015612676.1.37577 XP_015612678.1.37577 39947.LOC_Os09g32300.1 LOC_Os09g32300.1|13109.m03215|protein LOC_Os09g32300.1|PACid:21928403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]