SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os10g27470.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os10g27470.1
Domain Number 1 Region: 133-228
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0057
Further Details:      
 
Domain Number 2 Region: 469-541
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 3 Region: 53-111
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000543
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os10g27470.1
Sequence length 586
Comment (Oryza sativa)
Sequence
MNSYCDKKEVTVAFSKTKRQEEDEVIWRMVEQGATDDEECGGTNCSAGENRDPGWPGTSV
FRMLIPATKVGAVIGHSGERLRRLCEETKACVRVIGGHFAAAERAVIIFAKEQPDEPKPP
AIDALLRVYECIINDDGLDVRYNNIVVARILTPSEQAASLIGDQGSVINYIKKASKTNIH
VIDGDLPPVALEDDMIIEIWGLPARVHQALELVACHLRKYLVHRSVIPLFDPHVSIPISP
VDMPPFHYSDHHEGLLHEASPGYYSLYAEAFQLEHPWTDTSYSRYPMENFTHADIFEYRQ
EAPVFFGRYRSVTPPHYGHEAEAYLSSPMELCLHNNLNTYGWQATPPIGRSDTVERIRSL
ISVYGKQAHPHPLRQTYQSTKMEKHPHSGISLYRRDDHPTRVSPSPATELPPSPAVSAYK
WQVSPSLKMYPSTNVENLQHCRVSACAPEELPNVVVPSLTSQSPAVTSQVIMKMQVPIFY
AEAVIGPTGARIDYIRQASGSSVVIKDLDDSAMSIEITGSAATDVQIAEQLIKNFMAEAA
AASPDHSYDFIPSHLPAPRSPEPDIPTTSLTRRASCFTEPRLQATY
Download sequence
Identical sequences Q338C4
XP_015614628.1.37577 XP_015614629.1.37577 LOC_Os10g27470.1|PACid:21886130 39947.LOC_Os10g27470.1 LOC_Os10g27470.1|13110.m02361|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]