SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os10g41440.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os10g41440.1
Domain Number 1 Region: 326-398
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 49-110
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000057
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 3 Region: 147-231
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000906
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os10g41440.1
Sequence length 458
Comment (Oryza sativa)
Sequence
MADPAAAAAAAEFGDPDSPPAPAAEEAEAAAAVGEEAVPAAEAAAAKRWPGWPGDSVFRL
VVPVLKVGSIIGRKGELIKRLVEETKAKVRVLEGPVGATERIVLVSGKEDPALELPPAMD
ALMRVFKRVSGITDGAAEGTQAATAPGVCAARLLVPGAQAINLIGKQGASIKAIQEGTGA
TIRVISIDERERPFYVIEDERIVEIQGETEKVLKALQAVSNHLRKFLVDHSVLPLFEKTN
ATVTQDRSTDAWTDISHPSIVSAQINQPPPVVDEYILPMKRDPLFLEREPLIDHNIHRSG
VSLYGRDPALSTLRTSGIHGGGPGGPLLSQITQTMQIPLTYAEDIIGVKGANIAYIRANS
GAVVTIQESLGSPDDITVEMKGTSSQVQAAYQLIQDSLAAHRDSVRSSYAGLDPVYRPSY
SQYGSSTYPSSSLPSYSSMDGGGYSSSGLGGYGSSYRY
Download sequence
Identical sequences A2ZAB0 Q7XC34
LOC_Os10g41440.1|PACid:21883475 XP_015612742.1.37577 LOC_Os10g41440.1|13110.m03865|protein OsIBCD031488 39946.BGIOSIBCE033091 39947.LOC_Os10g41440.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]