SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 399599.Sbal195_0810 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399599.Sbal195_0810
Domain Number 1 Region: 6-148
Classification Level Classification E-value
Superfamily DR1885-like metal-binding protein 7.59e-45
Family DR1885-like metal-binding protein 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 399599.Sbal195_0810
Sequence length 160
Comment (Shewanella baltica OS195)
Sequence
MEFKTLKPIFKQLFNCLVLSCASFSALASVIVTEGHVRAMPETVPNTAAYFTLENHTDKA
VRLIGVSTTVAKDAQLHTIIEDQGMVKMRHVEGFDIPSHGALTLTPSGDHVMLLGLKAPL
VLEQQVELQLEFDDGEKMAITLPVSKEAENAAEQEHHHHH
Download sequence
Identical sequences A0A161UUU5 A3D8J3 A9L1S2 G0AXY3
gi|126175776|ref|YP_001051925.1| gi|152999317|ref|YP_001364998.1| gi|386342522|ref|YP_006038888.1| gi|386323280|ref|YP_006019397.1| WP_006083030.1.19221 WP_006083030.1.24904 WP_006083030.1.35668 WP_006083030.1.60405 WP_006083030.1.76213 WP_006083030.1.8014 WP_006083030.1.85636 WP_006083030.1.86146 WP_006083030.1.93117 gi|378707175|ref|YP_005272069.1| 325240.Sbal_3581 399599.Sbal195_0810 402882.Shew185_0778 gi|160873932|ref|YP_001553248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]