SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 399726.Teth514_0348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399726.Teth514_0348
Domain Number 1 Region: 187-256
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000000374
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0058
Further Details:      
 
Weak hits

Sequence:  399726.Teth514_0348
Domain Number - Region: 22-82
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00562
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399726.Teth514_0348
Sequence length 257
Comment (Thermoanaerobacter X514)
Sequence
MGDIKSNEILFSYKKCLEIGLTKSIVTPLISLEEDELKKRLQENKKLIEVFRKCVNRVRT
QLKKRYIFLLVDSEGYLLDVLYNKKIYKDITDLGIRRGTSFKEESCGTNAISLAMKLKQP
IYLKPEEHYCDIFKQWYCIATPFHIDNQIVGYLDISIIEHNMADEMMGFIDLLVYKIANE
YKREMDLESQEDLEKLTDKQIEIIKKCAKGYTELAISMELGLKPSTVKYHKKEIIKKLRV
KNFQQAIAKAIKLNLID
Download sequence
Identical sequences B0K2P4
399726.Teth514_0348 gi|307723589|ref|YP_003903340.1| gi|167039015|ref|YP_001662000.1| WP_009051813.1.26562 WP_009051813.1.81593 WP_009051813.1.95568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]