SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 399726.Teth514_1639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399726.Teth514_1639
Domain Number 1 Region: 292-485
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-53
Family Ribonuclease PH domain 1-like 0.0000107
Further Details:      
 
Domain Number 2 Region: 6-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-50
Family Ribonuclease PH domain 1-like 0.0000186
Further Details:      
 
Domain Number 3 Region: 144-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.94e-29
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 4 Region: 448-546
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.17e-27
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 606-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.82e-22
Family Cold shock DNA-binding domain-like 0.0004
Further Details:      
 
Domain Number 6 Region: 238-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.62e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0021
Further Details:      
 
Domain Number 7 Region: 550-627
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.25e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399726.Teth514_1639
Sequence length 700
Comment (Thermoanaerobacter X514)
Sequence
MEERTFEMELAGRKLLVQIGKVAQQANGAAWVKYGDTVVLVTACASKEPREGIDFFPLTV
EYEERLYSVGKIPGGFIKREGKPSEKAILSARLIDRPIRPLFPHGYRNDVQVIATVLSVD
PDVQPEIVAMIGSSVALSISDIPFDGPTGAVAVGLVDGQFIINPNHEQREKSLMHLVVSG
TKDAIVMVEAGAKEVPEETMLDAIMYAHEYIKQIVEFIEGIVKEVGVPKSEVILHEIDKE
LEEKVRAYATEKIYNALRTAEKKERNDNLDKVEQEVLEHFKEEYPDNLADIDEVLYNIMK
EQMRKMITEERIRVDGRGLDDIRPIWCEVGVLPRTHGSAIFTRGQTQVLTVATLGALGDI
QILDGIGDEEAKRYMHHYNFPPYSVGEVRPLRGPGRREIGHGALAERALEPVIPSEEEFP
YTIRLVSEVLSSNGSTSQASVCGSTLALMDAGVPIKAPVAGVAMGLIKEGDVVSVLTDIQ
GIEDFLGDMDFKVAGTEKGITAIQMDIKIPGIDKEILKMALEKARRGRLYILSKMLEVIK
EPRKQLSVYAPRVIRMVVDPEKIREIIGPGGKTISKIIAETGVKIDIEEDGRLYITASDL
RSGERAKQMIEAITKDIAVGEIYLGKVLRITPFGAFVEIAPGKEGLVHISKLSKKRVQKV
EDVVKVGDDILVKVTDIDKLGRISLSRKDALPDEEEEERN
Download sequence
Identical sequences B0K1D0 C7IPL0
gi|307724404|ref|YP_003904155.1| WP_003866759.1.26562 WP_003866759.1.47445 WP_003866759.1.81593 WP_003866759.1.95568 399726.Teth514_1639 gi|167040276|ref|YP_001663261.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]