SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 399741.Spro_0493 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399741.Spro_0493
Domain Number 1 Region: 4-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.48e-49
Family Ribonuclease PH domain 1-like 0.0000153
Further Details:      
 
Domain Number 2 Region: 290-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4e-47
Family Ribonuclease PH domain 1-like 0.0000151
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-29
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 450-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.17e-28
Family Ribonuclease PH domain 2-like 0.0000813
Further Details:      
 
Domain Number 5 Region: 608-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.54e-22
Family Cold shock DNA-binding domain-like 0.0000258
Further Details:      
 
Domain Number 6 Region: 554-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.4e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 399741.Spro_0493
Sequence length 705
Comment (Serratia proteamaculans 568)
Sequence
MLTPIIRKFQYGQHTLTIETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQSFFPLT
VNYQERTYAAGRIPGSFFRREGRPSEGETLTSRLIDRPIRPLFPDSFLNEVQVIATVVSL
NPQVNPDIVAMIGASAALSLSGIPFNGPIGSARVGYINNQYVLNPTSDELKESSLDLVVA
GTAGAVLMVESEADVLSEDQMLGAVVFGHEQQQIVIENINSLVAEAGKAKWDWQAPAVNE
ALHARVAELAEGRLGDAYHITEKQERYAQVDAIKSSVVETLLAQDETLDVSEIQDILGSV
EKNVVRSRVLRGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTAR
DAQNLDELMGEKTDSFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAMMPKPED
FPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEQDNFVVLSD
ILGDEDHLGDMDFKVAGSRDGITALQMDIKIEGITREIMQVALNQAKGARLHILGVMEQA
ISTPRGDISQFAPRIHTIRINPDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAAT
DGEKAKFAIRRIEEITAEIEVGRIYQGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVE
KVTDYLQMGQEVPVKVLEVDRQGRVRLSIKEATAPEAGSPAPEAE
Download sequence
Identical sequences A8G911
WP_012004951.1.18676 WP_012004951.1.35080 399741.Spro_0493 gi|157368740|ref|YP_001476729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]