SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 400667.A1S_0361 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400667.A1S_0361
Domain Number 1 Region: 264-455
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.69e-45
Family Ribonuclease PH domain 1-like 0.0000175
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.24e-37
Family Ribonuclease PH domain 1-like 0.0000986
Further Details:      
 
Domain Number 3 Region: 111-201
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.35e-30
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 4 Region: 417-515
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.24e-28
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 5 Region: 523-607
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.17e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 6 Region: 587-660
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.48e-20
Family Cold shock DNA-binding domain-like 0.00036
Further Details:      
 
Domain Number 7 Region: 205-288
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.89e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 400667.A1S_0361
Sequence length 662
Comment (Acinetobacter baumannii ATCC 17978)
Sequence
MGGVTVLVAVVAAPTAKAGQDFFPLTVNYQEKQYAAGRIPGGYGKREGRASEAETLISRL
IDRPIRPLFPEGYYNEIQVTATVVSSDKTMEADIAAMLGTSAALAIAGTPFRGPIGAARV
GLINGEYVLNPNFEQMAQSDLDLVVAGTESAVLMVESEAKELSEDQMLGAVLFGHDEMQI
AIQAINEFAAAAGAKPSDWVAPAHNEELRAKLKEAFEAKISEAYTIAVKQDRYAALDALH
AEAVAQFVPEEDVDGIADEVDYLFEDLKYRTVRDNILSGKPRIDGRDTKTVRALDVQVGV
LERAHGSALFTRGETQALVTTTLGNTRDALMVDTLAGTKTDNFMLHYNFPAYSVGETGRE
SGPKRREIGHGRLARRGVQAVLPAADRFPYVIRIVSDITESNGSSSMASVCGASLSLMDA
GVPLKAPVAGIAMGLVKEGERFAVLSDILGDEDHLGDMDFKVAGSANGITALQMDIKIEG
ITEEIMEVALNQAFAGRMHILNEMNKVISRARPEISMHAPTFEVITINPDKIRDVIGKGG
ATIRQITEETKAAIDIEDNGTVRVFGETKAAAKAAIAKIQAITAEVEPGKIYDGKVIRIV
EFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEGQEVKVQVQDVDNRGRIKLTMKDIE
QA
Download sequence
Identical sequences 400667.A1S_0361 gi|126640439|ref|YP_001083423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]