SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 400668.Mmwyl1_0629 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400668.Mmwyl1_0629
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 1.02e-30
Family Ribosomal protein L28 0.0000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 400668.Mmwyl1_0629
Sequence length 78
Comment (Marinomonas MWYL1)
Sequence
MSRVCQVTGKRPITGNNVSHSKRRTKRRFLPNLHWHRFWVEGENRYIRLRVSSKGMRIID
KKGIESVLAEIRANGEKV
Download sequence
Identical sequences A6VSY4
WP_011978458.1.45605 gi|152994663|ref|YP_001339498.1| 400668.Mmwyl1_0629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]